PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1157s0010.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 288aa    MW: 32689 Da    PI: 4.7251
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1157s0010.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.21.2e-072522812251
                             SSS--HHHHHHHHHHCTS-HHHHHHHHHHH CS
                Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNr 51 
                              +yp+++++  LA+++gL+++q+ +WF N+
  SapurV1A.1157s0010.2.p 252 WPYPTESDKIALAASTGLDQKQINNWFINQ 281
                             58*************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-1967111IPR005540KNOX1
PfamPF037901.1E-1969110IPR005540KNOX1
SMARTSM012562.3E-25117168IPR005541KNOX2
PfamPF037911.6E-24122167IPR005541KNOX2
PROSITE profilePS512139.097205225IPR005539ELK domain
SMARTSM011883.9E-4205226IPR005539ELK domain
PfamPF037895.8E-5205226IPR005539ELK domain
PROSITE profilePS5007110.025225287IPR001356Homeobox domain
SuperFamilySSF466893.46E-15226286IPR009057Homeodomain-like
SMARTSM003895.6E-4227285IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.7E-22230286IPR009057Homeodomain-like
CDDcd000867.75E-9237286No hitNo description
PfamPF059204.0E-14245281IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDGTYGLHSA VAGYSDKELM SPENLILQSE YQSLLSSEAF RLRTPILGSE EVLSEMASIR  60
TEEDMSTLIK AKIASHPCYP RLLEVYIDCQ KVGAPPGIAC FLDEIRREND LFKQDAVSTY  120
WGADPELDEF METYCELLVK YKSDLERPFD EATTFLNKIE MQLRNLCTGA SIRSLSDEGA  180
PSSDEELSGG ELDVHEAQPS GEDRELKDKL FRRFGGHIGT LKLELSKKKK KGKLPKEARQ  240
TLLGWWDVHY KWPYPTESDK IALAASTGLD QKQINNWFIN QLQHWWL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011045284.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-125KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLB9HLS51e-165B9HLS5_POPTR; Uncharacterized protein
STRINGVIT_01s0127g00210.t011e-138(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-111KNOTTED1-like homeobox gene 6